C H public
[search 0]
More
Download the App!
show episodes
 
Artwork

1
TruthFinder

Dr. C. H. E. Sadaphal

Unsubscribe
Unsubscribe
Monthly
 
#Truthfinder searches for crucial answers to critical questions about belief. Dr. C. H. E. Sadaphal scrutinizes non-belief, belief, science, supernaturalism and everything in between in the pursuit of clarity and meaningful answers.
  continue reading
 
Artwork

1
Hardcores & Casuals

Tim Town & J Smooth

Unsubscribe
Unsubscribe
Monthly+
 
Hosted by J-Smooth and Tim Town. J-Smooth is one of the UFC's biggest fans with a well of knowledge about past and upcoming fights as well as the fighters themselves. As for Tim Town..... Did we mention he is co-hosting the show? H&C offers commentary and insights on upcoming UFC and other sanctioned MMA fight tickets. We’ll cover the underdogs, the stars and throw a few favorites in the mix. We hope you enjoy.
  continue reading
 
Artwork

1
All Things Wedding

V I D A | C H I C

Unsubscribe
Unsubscribe
Monthly
 
All Things Wedding by Chavah Grant of Vida Chic Events. This podcast was created you give quick bite size tips to help you get through the wedding process with all your hair intact.
  continue reading
 
Artwork
 
Hello there igxgcgxgxchchchcjvkvk h h ch c gfhxohoxlhxlhxhchchcjvjvjvvjvhvhvjvkvjvjvhzufzfuzgjigzufzvjzkgzogzigxogxigxvkzkzigzigzigdgoxkgsoysitaktwktaktekgegkejysjgwkgwjtwitwitwktwktajfsmbdbxhffudtsgxgmdsjtstkwtiwiyeyieiyeyoxkhdkgdkhdkgskgskysiyeyoeoyeitekgdyoeyodyiwtisyisiysyisitsiteyisiysykslyskgskyegkskhdgolhdkhdhkdgkdhkdgodiyeyidgskysysydbbxgkskggsgkshlrlhzxchlsjfsjgskgsgksgleykehlstiatddmgxvmzmvdmgdkgeiteitwtiwkgsmvnsmcakgsktwyoeoyeoysmvzmvsmgsjtskgskyskhjdlhslysohskgsitwoywoyeoyryoeoye ...
  continue reading
 
Are you ready to feel less stressed, overwhelmed, and anxious? Do you wish you could be crazy confident in your ability to take on life’s challenges? This is the go-to podcast for understanding and building self-esteem and confidence. You will learn where confidence comes from, and how to increase yours. You may be surprised how easy it is to make small life changes that add up to give you more confidence and create BIG results. On the podcast, you will learn how to let go of perfectionism a ...
  continue reading
 
Just two friends who are entering into their twenties along with documenting their college experiences while trying to balancing out life ! keeping everything RAW and UNCUT. hoping to guide other females who are entering into college or may be in college. Creating a safe space for other females to relate to stories times, opinions, balance, growth, and walk with Christ.
  continue reading
 
Artwork
 
Project C Is an audio & visual Youtube podcast, hosted by Cina Ghiassi. The podcast will have a diverse range of guests to discuss a number of topics. All discussions are spoken about free of judgement with liberal view.
  continue reading
 
Home of CHAO Radio The voice of a contemporary China, and the people creating it. This is a place to celebrate talented people, from retailers to musicians, artist and designers, business leaders to people working on amazing social causes. We deliver insights into the thought-leaders shaping and influencing the urban city landscape and lifestyle throughout China and the rest of Pacific Asia. We want to attract like-minded people to join our community and create the good life together. Let us ...
  continue reading
 
podcast memes and that ~~~S P O T I F Y : ✧ http://tiny.cc/meinspotify ✧ A P P L E P O D C A S T S : ✧ http://tiny.cc/meinapplepodcast ✧ ~~~Y O U T U B E : ✧ http://tiny.cc/meinyoutube ✧ ~~~S N A P C H A T: ✧ @tahahadi14 ✧
  continue reading
 
Artwork

1
That Interview

That Station | Raleigh, North Carolina

Unsubscribe
Unsubscribe
Monthly+
 
That Interview is a conversation about music between the curators that play it and the artists that make it. An in depth look at an artists career, including insights into how they got started, their influences, creation process, successes, failures, and everything in between. That Interview is recorded at produced by That Station, a locally curated music station in Raleigh North Carolina with live personalities that share authentic stories and insights about music and life in the triangle. ...
  continue reading
 
Artwork
 
Carolina Panthers coverage, opinions, analysis, exclusive interviews and insight. Mid-week episodes preview the coming game and post-game episodes recap every Carolina Panthers win or loss with a focus on what worked, what didn't and what's next. Hosted by 99.9 The Fan's Tim Donnelly and Dennis Cox and WRAL's Chris Lea. Panthers Playbook is part of the Capitol Broadcasting Podcast Network from Raleigh, North Carolina.
  continue reading
 
Artwork

1
Mission Shunya

Girish Shivakumar

Unsubscribe
Unsubscribe
Monthly
 
Mission Shunya (Shunya=Zero) is all about the transition to a zero carbon economy. The podcast features conversations related to clean-tech and sustainability. A new podcast episode is released every fortnight. Experts from around the world are featured along with people whose businesses and actions are having a positive impact and aims to inspire every individual take action to do their bit for the planet. Renewable energy, electric vehicles, sustainable development, climate change, circula ...
  continue reading
 
Artwork

1
Project 1517

Timothy C. Bourman and Jonathan H. Bourman

Unsubscribe
Unsubscribe
Monthly
 
On October 31, 1517, Martin Luther posted the 95 Theses. These theses rocked the religious, social, and political establishment of his day. He did not come to his reformation on his own. In fact, it wasn't even his reformation. It was God's reformation won from Luther's deep, heartfelt encounter with the Word of God. We believe that we need world-shaking encounters with the Word of God like that...again. In this podcast, two twins, who also happen to be Lutheran pastors, will take listeners ...
  continue reading
 
Artwork

1
"Let's Talk About IT!"

Apostle Rosemary C Neverson RCN Ministries

Unsubscribe
Unsubscribe
Monthly
 
Dealing with real issues many are facing today every 3rd Wednesday's @6AM EST Live on our YouTube Channels. Also on Audio @7AM EST on 19 platforms. I am Apostle Rosemary of RCN Ministries. I will be focusing on FAITH~FAMILY~FOCUS. I will be speaking from the perspective of the role in which the church contributes in today's society. Our Moral Compass must point back to character, compassion, decency, honesty, honor, humility, integrity, love, morals, truth and unity. We cannot stay silent in ...
  continue reading
 
A Podcast Committed to: L ove E nergy C ommunity H ealing & E mpowerment. LECHE We Are is everything mindfulness. Join Hosts Eddie Pabon and Yasmin Caceres in empowering meaningful discussions around mental health and mindfulness. Support this podcast: https://podcasters.spotify.com/pod/show/lecheweare/support
  continue reading
 
Step aboard our cosmic vessel and embark on a thrilling journey through the annals of science fiction history. Delve into the realms of imagination with us as we traverse the vast expanses of the solar system, encountering aliens, robots, and spacefaring brigands amidst the twinkling stars. Our spacefaring odyssey takes us beyond the confines of light-years, venturing into the unknown to unveil the secrets of distant planets and the enigmatic beings that inhabit them. Join us three times a w ...
  continue reading
 
If you are currently going through a divorce or soon will be, Divorce and Your Money is the perfect podcast for you. The author, Shawn C. H. Leamon (MBA), is a professional and well-respected financial advisor and Certified Divorce Financial Analyst. His podcast provides real-world practical advice, including tips and checklists to help women and men protect their financial interests and future.
  continue reading
 
Artwork

1
Bat Rider and the Cave of Oomba

Anthony Barton on Podiobooks.com

Unsubscribe
Unsubscribe
Monthly
 
On the planet of the mile-high Yumi trees, only a few lucky boys and girls may fly bats to the treetops to harvest the fruit. Matthew John would like to join them, but to make his dream come true he must enter the cave of Oomba the lion. 'It was awesome. My 6-year old Liesel loved it.' -- K. W. in New York 'Farah and Sophie, aged 8 and 9, were sitting up in bed wondering what was going to happen next.' -- C. H. B. in Singapore
  continue reading
 
Artwork

1
Adventures of Bulldog Drummond

Humphrey Camardella Productions

Unsubscribe
Unsubscribe
Monthly
 
The British Hero Bulldog Drummond is a fictional character created by H. C. McNeile, as the hard boiled no nonsense-style detective. The stories followed Captain Hugh "Bulldog" Drummond, D.S.O., M.C., a wealthy former WWI officer of the Loamshire Regiment, who, after the war, spends his new-found leisure time as a private detective.Drummond is a proto-James Bond figure and was a muscular man with a group of followers who helped him in his adventures. They rounded up crooks and took them to a ...
  continue reading
 
Hello, my name is Urmila Baraily. This program is designed to share love and share experiences. Our focus is to encourage you through word of God and share story. Our mission is to Inform, Educate, and Inspire the next generation of leaders to take a stand for what is right.I believe everybody has a unique story to share. About me, I love food, music and I love to travel all over the world. Support this podcast: https://podcasters.spotify.com/pod/show/urmi-baraily/support
  continue reading
 
Finding good new music can be a full time job, so let KEXP help! In Our Headphones brings you five song recommendations every Monday, straight from KEXP’s DJs and Music Directors. We learn stories and insights about the artists, make connections between the music and the world around us, and get to know the diverse roster of DJs that make up the KEXP airwaves. Join hosts Janice Headley and Isabel Khalili on this never-ending journey of music discovery.
  continue reading
 
for promotional, entertainment, or educational purposes only. NOT for sale, or any other commercial purposes. Thanks be to God for making it all possible!! To the memory of Melvin Wharton (The man in the hat, you were admired more than you know), Ryan "Giggles" Reyes (I'm rolling steady with the punches brother), Rudy! (Still trying to tone it down brother!) and Jason Ulrich (I admired you solid, and you always had time to push me MAD forward) you've always believed in me, I am in eternal de ...
  continue reading
 
[̲̅H̲̅][̲̅A̲̅][̲̅G̲̅][̲̅A̲̅] [̲̅C̲̅][̲̅L̲̅][̲̅I̲̅][̲̅C̲̅] [̲̅A̲̅][̲̅Q̲̅][̲̅U̲̅]Í ➽ 【 https://bit.ly/2ZyMiZd 】 ▼ ╰☆╮VER PELICULA COMPLETA ➤➤ https://tinyurl.com/y6fjcknm ▬▬▬▬▬▬▬▬▬▬▬▬▬▬ஜ۩۞۩ஜ▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Fecha de estreno 22 de noviembre de 2019 (1h 43min) Dirigida por Jennifer Lee, Chris Buck Reparto Idina Menzel, Kristen Bell, Josh Gad más
  continue reading
 
Exploring big ideas and the way that stories can help us feel seen, understood, and valued. The Children's Book Podcast features insightful and sincere interviews with authors, illustrators, and everyone involved in taking a book from drawing board to bookshelf. Hosted by a teacher and school librarian, each episode seeks to connect kids and listeners of all ages to powerful, impactful, and lasting stories, and the people who tell them.
  continue reading
 
Loading …
show series
 
Ep# 206 - Limitless - Part 1Work with Schlyce:Elevate: Monthly Training, Coaching, and Mentorship ProgramDive into 'Elevate,' a transformative program that heals the illusion of separation from God and awakens you to Christ within. It's a blend of monthly training, coaching, and mentorship, revolutionizing your spiritual journey and personal growth…
  continue reading
 
June 16– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “I give eternal life to (those who believe in me), and they will never die.” —John 10:28 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
  continue reading
 
June 29– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Those who have fallen asleep.” —1 Thessalonians 4:14 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
  continue reading
 
It’s remarkable what a bright, eager youngster can accomplish with just a pail and a shovel. The Deep Hole to China by Robert Sheckley, that’s next on The Lost Sci-Fi Podcast. You asked for it, and here it is another super short story. From Fantastic Universe Magazine in June 1955 on page 125, The Deep Hole to China by Robert Sheckley… Next on The …
  continue reading
 
A new MP3 sermon from Maidenbower Baptist Church is now available on SermonAudio with the following details: Title: Pride Catechized and Condemned (sermon 1271) Subtitle: From the heart of Spurgeon Speaker: C. H. Spurgeon Broadcaster: Maidenbower Baptist Church Event: Podcast Date: 6/28/2024 Bible: 1 Corinthians 4:7 Length: 31 min.…
  continue reading
 
Not until after earning his PhD and in his 30’s did Bill begin drinking obsessively. After a year of white-knuckling his sobriety, he rewarded himself with drinking and earned a DUI – and that brought him to the program and to today, with 14 years of sobriety. Quotes “I didn’t fit the stereotype that I had of what an “alcoholic” was.” “For me, the …
  continue reading
 
June 27– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Only don’t go very far away.” —Exodus 8:28 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
  continue reading
 
Jenna lost her husband last summer to a brain cancer. I met her at a recent Victory Center event where she was a featured speaker sharing her and her kid's journey. She's also started her own endeavor to ensure those enduring a cancer battle can be pointed to the most effective resources. AND she shares what Camp Kesem is, and how helpful it was fo…
  continue reading
 
June 26– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Have you become like the rest of us?” —Isaiah 14:10 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
  continue reading
 
When was the last time you felt alive, full of ideas and energy, and seemed to be on fire for your life? Many of us feel stuck, off track, or stifled. Whether that is because we feel bored, overwhelmed, or we find ourselves in places we don’t really want to be. This can be highly demotivating. Maybe it’s the job you are in, your workout routine, or…
  continue reading
 
In this Summer Episode Swap, Picture Book Podcast host Chris Marland shares his “Teachers That Inspire Us” episode featuring Why Teaching?, written by Dr. Jen Mott and illustrated by Sara Relojo. Visit Picture Book Podcast online at Picture Book Podcast You can pick up your own copy of Why Teaching? wherever books are found. Consider supporting ind…
  continue reading
 
June 25– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Climb up into a high mountain (and proclaim the glory of God).” —Isaiah 40:9 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
  continue reading
 
June 24– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “A certain woman in the crowd shouted to Jesus and said, ‘Blessed is the womb that gave birth to you, and the breasts that fed you.’ But he answered, ‘Blessed are those that hear the word of God and keep it.” —Luke 11:27-28 Today's FREE Transcript Get a copy of the book, Morning b…
  continue reading
 
DJ Kennady Quille, host of KEXP’s Pacific Northwest music show, Audioasis, shares three songs with a Northwest focus, as well as the first new music in 19 years from a legendary Olympia, WA queercore band. Plus, KEXP Music Director Chris Sanley shares a stunning slow-burn single off the debut LP of a Brooklyn-based artist on the verge of a breakout…
  continue reading
 
The essential requirements of a first-class triggerman are two: that he know how to pull the trigger–and when not to! Triggerman By J. F. Bone, that’s next on The Lost Sci-Fi Podcast. Jesse Franklin Bone was born in Tacoma Washington in 1916. Before he was an author Bone was a veterinarian, and a professor of veterinary medicine, served in the U.S.…
  continue reading
 
Ripped by an asteroid stray, the space-ship drifted helplessly … until suddenly, across the shuddering deeps, a strange voice called to her. Runaway by Alfred Coppel, that’s next on The Lost Sci-Fi Podcast. Alfred Coppel has been on the podcast before, with The First Man on the Moon, Wreck Off Titan and The Flight of the Eagle. Every one of them a …
  continue reading
 
June 22– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “He will build the temple of the Lord and will receive the glory of his throne.” —Zechariah 6:13 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
  continue reading
 
June 21– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “You are more beautiful than the children of men.” —Psalm 45:2 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
  continue reading
 
Dennis Cox & Chris Lea discuss Carolina Panthers Blueprint Episode 2 and the clear alignment between GM Dan Morgan, head coach Dave Canales, and Executive VP of Football Operations Brandt Tillis when it comes to building the roster through NFL free agency and the NFL Draft. Also, will running back Miles Sanders make the final roster? Plus, more on …
  continue reading
 
Mad with despair, they fought back from the ruins. Whoever these invaders were, they should not have a world which its defenders themselves had destroyed! The Burnt Planet William Brittain, that’s next on The Lost Sci-Fi Podcast. If the name William Brittain rings a bell, you know your vintage science fiction. He’s another one of those authors that…
  continue reading
 
All those mall memories. That's all they are now. But also NOW is the arrival of the Enclave and the all new, and now open Northwood Community Center at the old mall spot. Fitness center, pickleball, event areas, art galleries...a free splash pad, and perhaps a hockey rink to come. Thank you to NW Director of Recreation Patrick McGarahan and City A…
  continue reading
 
June 20– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “I will sift the house of Israel among the nations, like wheat in a sieve; but not even the smallest grain will fall to the earth.” —Amos 9:9 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening t…
  continue reading
 
After her first time drinking, Kaycie found herself in an alcohol diversion program, but could not wait to drink again. After years of pain and the gift of desperation, Kaycie became willing to do what it takes to get and maintain sobriety. Quotes “I didn’t realize that alcohol was the root of the problem.” “I wanted a better life for myself and I …
  continue reading
 
A Fantasy of perfection and imperfection. A tale of a quaint city in the jungle and the curious fate that overtook a very clever thief who came there. The Unfinished City by Donald A. Wollheim, that’s next on The Lost Sci-Fi Podcast. Another 5 star review on Apple Podcasts, just so you know, your 5 star reviews never get old! This from Slacker Jake…
  continue reading
 
June 19– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Filled with the Holy Spirit.” —Acts 2:4 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
  continue reading
 
Holden made love to his friends wife. Because he couldn’t help it. The Portable Star by Isaac Asimov, that’s next on The Lost Sci-Fi Podcast. There will come a time when we will run out of stories in the public domain to share with you that were written by Isaac Asimov, fortunately today, is not that day. Considering when it was published in 1955 t…
  continue reading
 
Loading …

Quick Reference Guide