The latest podcast feed searching 'C. H. Spurgeon' on SermonAudio.
…
continue reading
EXPERIENCE MORE OF THE THE CHRIST IN YOU!
…
continue reading
C. H. (Charles Haddon) Spurgeon's classic Morning & Evening devotional readings-- slightly revised, edited, and voiced by W. C. Neff.
…
continue reading
Intelligent faith provides clarity and meaningful answers about God, the Bible and your Christian life. Visit wcsk.org.
…
continue reading
…
continue reading
On the air on Q105 Toledo 3-7p, and this is where all of our long form content, commentary, guests and interviews are!
…
continue reading
#Truthfinder searches for crucial answers to critical questions about belief. Dr. C. H. E. Sadaphal scrutinizes non-belief, belief, science, supernaturalism and everything in between in the pursuit of clarity and meaningful answers.
…
continue reading
New podcast weblog🎬Schau Jetzt👉 ( https://t.co/R3Z6rAQBe2 ) 🎬Schau Jetzt👉 ( https://bit.ly/2PjrMb4 ) 5. März 2020 / 1 Std. 40 Min. / Animation, Fantasy Von Dan Scanlon Mit Annette Frier, Tom Holland, Chris Pratt Produktionsland Amerikanische
…
continue reading
🎬Schau Jetzt👉 ( https://bit.ly/2HM8c3c ) 🎬Schau Jetzt👉 ( https://t.co/sX5IdVylE6 ) 27. Februar 2020 / 2 Std. 05 Min. / Fantasy, Horror, Thriller Von Leigh Whannell Mit Elisabeth Moss, Oliver Jackson-Cohen, Harriet Dyer Produktionsland Amerikanische
…
continue reading
Hosted by J-Smooth and Tim Town. J-Smooth is one of the UFC's biggest fans with a well of knowledge about past and upcoming fights as well as the fighters themselves. As for Tim Town..... Did we mention he is co-hosting the show? H&C offers commentary and insights on upcoming UFC and other sanctioned MMA fight tickets. We’ll cover the underdogs, the stars and throw a few favorites in the mix. We hope you enjoy.
…
continue reading
All Things Wedding by Chavah Grant of Vida Chic Events. This podcast was created you give quick bite size tips to help you get through the wedding process with all your hair intact.
…
continue reading
Hello there igxgcgxgxchchchcjvkvk h h ch c gfhxohoxlhxlhxhchchcjvjvjvvjvhvhvjvkvjvjvhzufzfuzgjigzufzvjzkgzogzigxogxigxvkzkzigzigzigdgoxkgsoysitaktwktaktekgegkejysjgwkgwjtwitwitwktwktajfsmbdbxhffudtsgxgmdsjtstkwtiwiyeyieiyeyoxkhdkgdkhdkgskgskysiyeyoeoyeitekgdyoeyodyiwtisyisiysyisitsiteyisiysykslyskgskyegkskhdgolhdkhdhkdgkdhkdgodiyeyidgskysysydbbxgkskggsgkshlrlhzxchlsjfsjgskgsgksgleykehlstiatddmgxvmzmvdmgdkgeiteitwtiwkgsmvnsmcakgsktwyoeoyeoysmvzmvsmgsjtskgskyskhjdlhslysohskgsitwoywoyeoyryoeoye ...
…
continue reading
By hearing the Word of God, you will be drawn closer to Him. Dr. Sadaphal preaches Christ, will teach you the Bible, and will transform you into a strong disciple. Visit wcsk.org for more valuable resources.
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Jetzt ((Schau)) Die Eiskönigin 2 Ganzer (d-e-u-t-s-c-h) kostenlos ||HD-720p
ganzerfilmedeutschland
[HD] >> https://tinyurl.com/y2hkknv4 || Starttermin 20. November 2019 (1 Std. 44 Min.) Von Jennifer Lee, Chris Buck Mit Willemijn Verkaik, Hape Kerkeling, Lara Loft
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Crazy Confidence Coach Podcast Mindset, Limiting Beliefs, Reinvention, Purpose, Certified Life Coach, Self-Doubt, Negative Thought Patterns, Managing the Mind, Major Life Changes
Heather Edwards with H C Edwards Coaching and The Crazy Confidence Coach
Are you ready to feel less stressed, overwhelmed, and anxious? Do you wish you could be crazy confident in your ability to take on life’s challenges? This is the go-to podcast for understanding and building self-esteem and confidence. You will learn where confidence comes from, and how to increase yours. You may be surprised how easy it is to make small life changes that add up to give you more confidence and create BIG results. On the podcast, you will learn how to let go of perfectionism a ...
…
continue reading
part of c h i l d - f r e e . c o m
…
continue reading
. Cover art photo provided by Bia Andrade on Unsplash: https://unsplash.com/@biawashere
…
continue reading
Random
…
continue reading
A jack of all trades podcast targeted at teens C- Creativity H- Health I- Innovation B- Business I- Information
…
continue reading
Just two friends who are entering into their twenties along with documenting their college experiences while trying to balancing out life ! keeping everything RAW and UNCUT. hoping to guide other females who are entering into college or may be in college. Creating a safe space for other females to relate to stories times, opinions, balance, growth, and walk with Christ.
…
continue reading
Project C Is an audio & visual Youtube podcast, hosted by Cina Ghiassi. The podcast will have a diverse range of guests to discuss a number of topics. All discussions are spoken about free of judgement with liberal view.
…
continue reading
Podcast by Mack I. Evan C. and Trevor H.
…
continue reading
Home of CHAO Radio The voice of a contemporary China, and the people creating it. This is a place to celebrate talented people, from retailers to musicians, artist and designers, business leaders to people working on amazing social causes. We deliver insights into the thought-leaders shaping and influencing the urban city landscape and lifestyle throughout China and the rest of Pacific Asia. We want to attract like-minded people to join our community and create the good life together. Let us ...
…
continue reading
podcast memes and that ~~~S P O T I F Y : ✧ http://tiny.cc/meinspotify ✧ A P P L E P O D C A S T S : ✧ http://tiny.cc/meinapplepodcast ✧ ~~~Y O U T U B E : ✧ http://tiny.cc/meinyoutube ✧ ~~~S N A P C H A T: ✧ @tahahadi14 ✧
…
continue reading
That Interview is a conversation about music between the curators that play it and the artists that make it. An in depth look at an artists career, including insights into how they got started, their influences, creation process, successes, failures, and everything in between. That Interview is recorded at produced by That Station, a locally curated music station in Raleigh North Carolina with live personalities that share authentic stories and insights about music and life in the triangle. ...
…
continue reading
The newest sermons from Prince of Preachers on SermonAudio.
…
continue reading
C. ultivating H. Hope,Health,Humor,HipHop, Happiness, O. n M. y P. lanet Support this podcast: https://podcasters.spotify.com/pod/show/lilyfangz/support
…
continue reading
Bet that up sports podcast bringing you the latest in sports, hip-hop, and current events new episodes every week
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Panthers Playbook | Carolina Panthers podcast from 99.9 The Fan
99.9 The Fan Podcasts | Raleigh, North Carolina
Carolina Panthers coverage, opinions, analysis, exclusive interviews and insight. Mid-week episodes preview the coming game and post-game episodes recap every Carolina Panthers win or loss with a focus on what worked, what didn't and what's next. Hosted by 99.9 The Fan's Tim Donnelly and Dennis Cox and WRAL's Chris Lea. Panthers Playbook is part of the Capitol Broadcasting Podcast Network from Raleigh, North Carolina.
…
continue reading
Weekly sermons from Freedom Church of Philadelphia. For more information, visit our website at wearefreedomchurch.org.
…
continue reading
Mission Shunya (Shunya=Zero) is all about the transition to a zero carbon economy. The podcast features conversations related to clean-tech and sustainability. A new podcast episode is released every fortnight. Experts from around the world are featured along with people whose businesses and actions are having a positive impact and aims to inspire every individual take action to do their bit for the planet. Renewable energy, electric vehicles, sustainable development, climate change, circula ...
…
continue reading
On October 31, 1517, Martin Luther posted the 95 Theses. These theses rocked the religious, social, and political establishment of his day. He did not come to his reformation on his own. In fact, it wasn't even his reformation. It was God's reformation won from Luther's deep, heartfelt encounter with the Word of God. We believe that we need world-shaking encounters with the Word of God like that...again. In this podcast, two twins, who also happen to be Lutheran pastors, will take listeners ...
…
continue reading
Dealing with real issues many are facing today every 3rd Wednesday's @6AM EST Live on our YouTube Channels. Also on Audio @7AM EST on 19 platforms. I am Apostle Rosemary of RCN Ministries. I will be focusing on FAITH~FAMILY~FOCUS. I will be speaking from the perspective of the role in which the church contributes in today's society. Our Moral Compass must point back to character, compassion, decency, honesty, honor, humility, integrity, love, morals, truth and unity. We cannot stay silent in ...
…
continue reading
A Podcast Committed to: L ove E nergy C ommunity H ealing & E mpowerment. LECHE We Are is everything mindfulness. Join Hosts Eddie Pabon and Yasmin Caceres in empowering meaningful discussions around mental health and mindfulness. Support this podcast: https://podcasters.spotify.com/pod/show/lecheweare/support
…
continue reading
Step aboard our cosmic vessel and embark on a thrilling journey through the annals of science fiction history. Delve into the realms of imagination with us as we traverse the vast expanses of the solar system, encountering aliens, robots, and spacefaring brigands amidst the twinkling stars. Our spacefaring odyssey takes us beyond the confines of light-years, venturing into the unknown to unveil the secrets of distant planets and the enigmatic beings that inhabit them. Join us three times a w ...
…
continue reading
If you are currently going through a divorce or soon will be, Divorce and Your Money is the perfect podcast for you. The author, Shawn C. H. Leamon (MBA), is a professional and well-respected financial advisor and Certified Divorce Financial Analyst. His podcast provides real-world practical advice, including tips and checklists to help women and men protect their financial interests and future.
…
continue reading
On the planet of the mile-high Yumi trees, only a few lucky boys and girls may fly bats to the treetops to harvest the fruit. Matthew John would like to join them, but to make his dream come true he must enter the cave of Oomba the lion. 'It was awesome. My 6-year old Liesel loved it.' -- K. W. in New York 'Farah and Sophie, aged 8 and 9, were sitting up in bed wondering what was going to happen next.' -- C. H. B. in Singapore
…
continue reading
The British Hero Bulldog Drummond is a fictional character created by H. C. McNeile, as the hard boiled no nonsense-style detective. The stories followed Captain Hugh "Bulldog" Drummond, D.S.O., M.C., a wealthy former WWI officer of the Loamshire Regiment, who, after the war, spends his new-found leisure time as a private detective.Drummond is a proto-James Bond figure and was a muscular man with a group of followers who helped him in his adventures. They rounded up crooks and took them to a ...
…
continue reading
Hello, my name is Urmila Baraily. This program is designed to share love and share experiences. Our focus is to encourage you through word of God and share story. Our mission is to Inform, Educate, and Inspire the next generation of leaders to take a stand for what is right.I believe everybody has a unique story to share. About me, I love food, music and I love to travel all over the world. Support this podcast: https://podcasters.spotify.com/pod/show/urmi-baraily/support
…
continue reading
Finding good new music can be a full time job, so let KEXP help! In Our Headphones brings you five song recommendations every Monday, straight from KEXP’s DJs and Music Directors. We learn stories and insights about the artists, make connections between the music and the world around us, and get to know the diverse roster of DJs that make up the KEXP airwaves. Join hosts Janice Headley and Isabel Khalili on this never-ending journey of music discovery.
…
continue reading
She was murdered in 1979. Web sleuths helped ID her. Can this podcast help find her killer?
…
continue reading
a e s t h e t i c ~ v I b e s
…
continue reading
We bring the AA Speaker to the microphone to record their story of recovery, creating “Speaker Tapes” for this generation. Website: KeepComingBack.net
…
continue reading
for promotional, entertainment, or educational purposes only. NOT for sale, or any other commercial purposes. Thanks be to God for making it all possible!! To the memory of Melvin Wharton (The man in the hat, you were admired more than you know), Ryan "Giggles" Reyes (I'm rolling steady with the punches brother), Rudy! (Still trying to tone it down brother!) and Jason Ulrich (I admired you solid, and you always had time to push me MAD forward) you've always believed in me, I am in eternal de ...
…
continue reading
[̲̅H̲̅][̲̅A̲̅][̲̅G̲̅][̲̅A̲̅] [̲̅C̲̅][̲̅L̲̅][̲̅I̲̅][̲̅C̲̅] [̲̅A̲̅][̲̅Q̲̅][̲̅U̲̅]Í ➽ 【 https://bit.ly/2ZyMiZd 】 ▼ ╰☆╮VER PELICULA COMPLETA ➤➤ https://tinyurl.com/y6fjcknm ▬▬▬▬▬▬▬▬▬▬▬▬▬▬ஜ۩۞۩ஜ▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Fecha de estreno 22 de noviembre de 2019 (1h 43min) Dirigida por Jennifer Lee, Chris Buck Reparto Idina Menzel, Kristen Bell, Josh Gad más
…
continue reading
Exploring big ideas and the way that stories can help us feel seen, understood, and valued. The Children's Book Podcast features insightful and sincere interviews with authors, illustrators, and everyone involved in taking a book from drawing board to bookshelf. Hosted by a teacher and school librarian, each episode seeks to connect kids and listeners of all ages to powerful, impactful, and lasting stories, and the people who tell them.
…
continue reading
A new MP3 sermon from Dr David C. Mackereth is now available on SermonAudio with the following details: Title: The Claims of God. Subtitle: C H Spurgeon Speaker: C. H. Spurgeon Broadcaster: Dr David C. Mackereth Event: Sunday Service Date: 6/28/2024 Bible: Psalm 100:3-5 Length: 51 min.
…
continue reading
Ep# 206 - Limitless - Part 1Work with Schlyce:Elevate: Monthly Training, Coaching, and Mentorship ProgramDive into 'Elevate,' a transformative program that heals the illusion of separation from God and awakens you to Christ within. It's a blend of monthly training, coaching, and mentorship, revolutionizing your spiritual journey and personal growth…
…
continue reading
By Gabriel Bouch
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 16– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “I give eternal life to (those who believe in me), and they will never die.” —John 10:28
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 16– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “I give eternal life to (those who believe in me), and they will never die.” —John 10:28 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 29– 1 Thessalonians 4:14, “Those who have fallen asleep.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 29– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Those who have fallen asleep.” —1 Thessalonians 4:14 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Deep Hole To China by Robert Sheckley
11:56
11:56
Play later
Play later
Lists
Like
Liked
11:56
It’s remarkable what a bright, eager youngster can accomplish with just a pail and a shovel. The Deep Hole to China by Robert Sheckley, that’s next on The Lost Sci-Fi Podcast. You asked for it, and here it is another super short story. From Fantastic Universe Magazine in June 1955 on page 125, The Deep Hole to China by Robert Sheckley… Next on The …
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Pride Catechized and Condemned (sermon 1271)
31:00
31:00
Play later
Play later
Lists
Like
Liked
31:00
A new MP3 sermon from Maidenbower Baptist Church is now available on SermonAudio with the following details: Title: Pride Catechized and Condemned (sermon 1271) Subtitle: From the heart of Spurgeon Speaker: C. H. Spurgeon Broadcaster: Maidenbower Baptist Church Event: Podcast Date: 6/28/2024 Bible: 1 Corinthians 4:7 Length: 31 min.…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 28– Hebrews 12:2, “Looking unto Jesus.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 28– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Looking unto Jesus.” —Hebrews 12:2 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
![Artwork](/static/images/128pixel.png)
1
A Good Start! A Book For Young Men and Women
37:00
37:00
Play later
Play later
Lists
Like
Liked
37:00
A new MP3 sermon from The Narrated Puritan is now available on SermonAudio with the following details: Title: A Good Start! A Book For Young Men and Women Subtitle: Spurgeon's Sermon Speaker: C. H. Spurgeon Broadcaster: The Narrated Puritan Event: Audiobook Date: 6/27/2024 Length: 37 min.
…
continue reading
OK, so the name wasn't Stickshift. Clarity on that and SO much more about this Hulu movie that spent a lot of time filming here in Toledo with Charles Wetzel from Film Toledo. And what comes to my mind when I hear the actual title of the movie HEREBy Eric Chase
…
continue reading
There's SO much more than rides, food and animals. Especially if you know a kid or teen who is looking to keep busy, make friends and learn important life skills! Thanks to Kathy, Jess and TWO TIME 4H STATE PHOTOG CHAMP Hannah for visiting!By Eric Chase
…
continue reading
Not until after earning his PhD and in his 30’s did Bill begin drinking obsessively. After a year of white-knuckling his sobriety, he rewarded himself with drinking and earned a DUI – and that brought him to the program and to today, with 14 years of sobriety. Quotes “I didn’t fit the stereotype that I had of what an “alcoholic” was.” “For me, the …
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 27– Exodus 8:28, “Only don’t go very far away.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 27– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Only don’t go very far away.” —Exodus 8:28 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
A new MP3 sermon from Iglesia Bautista de la Gracia CDMX is now available on SermonAudio with the following details: Title: Todo por Gracia 13 y 14 Subtitle: Todo por Gracia AudioLibro Speaker: C. H. Spurgeon Broadcaster: Iglesia Bautista de la Gracia CDMX Event: Audiobook Date: 1/11/1886 Bible: Romans 5:20 Length: 15 min.…
…
continue reading
Jenna lost her husband last summer to a brain cancer. I met her at a recent Victory Center event where she was a featured speaker sharing her and her kid's journey. She's also started her own endeavor to ensure those enduring a cancer battle can be pointed to the most effective resources. AND she shares what Camp Kesem is, and how helpful it was fo…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 26– Isaiah 14:10, “Have you become like the rest of us?”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 26– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Have you become like the rest of us?” —Isaiah 14:10 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
One appropriate saying would be dying on the vine. Self inflicted wounds. Watching them suffer. All explain what I witnessed when Sheetz tried to extol their virtues to the Airport and Bernath community. Thank you to the Metroparks and MANY more! Why is she popular? Be honest. An Amazon thing is going to come to physical shelves.…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Japanese House - Amber Bain | That Interview
11:47
11:47
Play later
Play later
Lists
Like
Liked
11:47
The Japanese House - Amber Bain - sits down for an interview to talk with That Station about inspiration, musical beginnings, Taylor Swift, & her new engagement.
…
continue reading
![Artwork](/static/images/128pixel.png)
1
EP34// How to Get Back on Track When You Are Feeling Stuck
11:20
11:20
Play later
Play later
Lists
Like
Liked
11:20
When was the last time you felt alive, full of ideas and energy, and seemed to be on fire for your life? Many of us feel stuck, off track, or stifled. Whether that is because we feel bored, overwhelmed, or we find ourselves in places we don’t really want to be. This can be highly demotivating. Maybe it’s the job you are in, your workout routine, or…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Summer Episode Swap with Picture Book Podcast
35:14
35:14
Play later
Play later
Lists
Like
Liked
35:14
In this Summer Episode Swap, Picture Book Podcast host Chris Marland shares his “Teachers That Inspire Us” episode featuring Why Teaching?, written by Dr. Jen Mott and illustrated by Sara Relojo. Visit Picture Book Podcast online at Picture Book Podcast You can pick up your own copy of Why Teaching? wherever books are found. Consider supporting ind…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 25– Isaiah 40:9, “Climb up into a high mountain (and proclaim the glory of God).”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 25– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Climb up into a high mountain (and proclaim the glory of God).” —Isaiah 40:9 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 24– Luke 11:27-28, “A certain woman in the crowd shouted to Jesus and said, ‘Blessed is the womb that gave birth to you, and the breasts that fed you.’ But he answered, ‘Blessed are those that hear ...
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 24– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “A certain woman in the crowd shouted to Jesus and said, ‘Blessed is the womb that gave birth to you, and the breasts that fed you.’ But he answered, ‘Blessed are those that hear the word of God and keep it.” —Luke 11:27-28 Today's FREE Transcript Get a copy of the book, Morning b…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Kennady Quille: Thavoron, VIANNE, Pantsuitguy
26:37
26:37
Play later
Play later
Lists
Like
Liked
26:37
DJ Kennady Quille, host of KEXP’s Pacific Northwest music show, Audioasis, shares three songs with a Northwest focus, as well as the first new music in 19 years from a legendary Olympia, WA queercore band. Plus, KEXP Music Director Chris Sanley shares a stunning slow-burn single off the debut LP of a Brooklyn-based artist on the verge of a breakout…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Triggerman by J.F. Bone - Hugo Award Nominee For Best Short Story in 1959
31:28
31:28
Play later
Play later
Lists
Like
Liked
31:28
The essential requirements of a first-class triggerman are two: that he know how to pull the trigger–and when not to! Triggerman By J. F. Bone, that’s next on The Lost Sci-Fi Podcast. Jesse Franklin Bone was born in Tacoma Washington in 1916. Before he was an author Bone was a veterinarian, and a professor of veterinary medicine, served in the U.S.…
…
continue reading
June 23– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “…a cake unturned.” —Hosea 7:8 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Runaway by Alfred Coppel - Posessed Space Ships
46:27
46:27
Play later
Play later
Lists
Like
Liked
46:27
Ripped by an asteroid stray, the space-ship drifted helplessly … until suddenly, across the shuddering deeps, a strange voice called to her. Runaway by Alfred Coppel, that’s next on The Lost Sci-Fi Podcast. Alfred Coppel has been on the podcast before, with The First Man on the Moon, Wreck Off Titan and The Flight of the Eagle. Every one of them a …
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 22– Zechariah 6:13, “He will build the temple of the Lord and will receive the glory of his throne.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 22– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “He will build the temple of the Lord and will receive the glory of his throne.” —Zechariah 6:13 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
…
continue reading
A new MP3 sermon from Dr David C. Mackereth is now available on SermonAudio with the following details: Title: Jesus Meeting His Warriors Subtitle: C H Spurgeon Speaker: C. H. Spurgeon Broadcaster: Dr David C. Mackereth Event: Sunday Service Date: 6/21/2024 Bible: Genesis 14 Length: 48 min.
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 21– Psalm 45:2, “You are more beautiful than the children of men.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 21– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “You are more beautiful than the children of men.” —Psalm 45:2 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Carolina Panthers have alignment; will RB Miles Sanders be cut?
24:15
24:15
Play later
Play later
Lists
Like
Liked
24:15
Dennis Cox & Chris Lea discuss Carolina Panthers Blueprint Episode 2 and the clear alignment between GM Dan Morgan, head coach Dave Canales, and Executive VP of Football Operations Brandt Tillis when it comes to building the roster through NFL free agency and the NFL Draft. Also, will running back Miles Sanders make the final roster? Plus, more on …
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Burnt Planet by William Brittain - Short Sci Fi Story From the 1940s
18:24
18:24
Play later
Play later
Lists
Like
Liked
18:24
Mad with despair, they fought back from the ruins. Whoever these invaders were, they should not have a world which its defenders themselves had destroyed! The Burnt Planet William Brittain, that’s next on The Lost Sci-Fi Podcast. If the name William Brittain rings a bell, you know your vintage science fiction. He’s another one of those authors that…
…
continue reading
All those mall memories. That's all they are now. But also NOW is the arrival of the Enclave and the all new, and now open Northwood Community Center at the old mall spot. Fitness center, pickleball, event areas, art galleries...a free splash pad, and perhaps a hockey rink to come. Thank you to NW Director of Recreation Patrick McGarahan and City A…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 20– Amos 9:9, “I will sift the house of Israel among the nations, like wheat in a sieve; but not even the smallest grain will fall to the earth.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 20– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “I will sift the house of Israel among the nations, like wheat in a sieve; but not even the smallest grain will fall to the earth.” —Amos 9:9 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening t…
…
continue reading
After her first time drinking, Kaycie found herself in an alcohol diversion program, but could not wait to drink again. After years of pain and the gift of desperation, Kaycie became willing to do what it takes to get and maintain sobriety. Quotes “I didn’t realize that alcohol was the root of the problem.” “I wanted a better life for myself and I …
…
continue reading
![Artwork](/static/images/128pixel.png)
1
Big Macs, Anal Leakage and Fight Night
1:02:42
1:02:42
Play later
Play later
Lists
Like
Liked
1:02:42
I think the title tells the story.By Tim Town & J Smooth
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Unfinished City by Donald A. Wollheim - Science Fiction Short Story From the 1950s
26:19
26:19
Play later
Play later
Lists
Like
Liked
26:19
A Fantasy of perfection and imperfection. A tale of a quaint city in the jungle and the curious fate that overtook a very clever thief who came there. The Unfinished City by Donald A. Wollheim, that’s next on The Lost Sci-Fi Podcast. Another 5 star review on Apple Podcasts, just so you know, your 5 star reviews never get old! This from Slacker Jake…
…
continue reading
A new MP3 sermon from Hackberry House of Chosun is now available on SermonAudio with the following details: Title: The Unity Christ Prayed For Subtitle: Spurgeon sermons Speaker: C. H. Spurgeon Broadcaster: Hackberry House of Chosun Event: Teaching Date: 6/20/2024 Bible: John 17:21 Length: 13 min.
…
continue reading
RetroSkate 2 is on! For Friday night, as the heat advisory winds down. Why!? Glad you asked. Some big actors in this movie filming here. Get some of your $105m! Customer service fumbles. One of THE greatest ever is gone.By Eric Chase
…
continue reading
A new MP3 sermon from Maidenbower Baptist Church is now available on SermonAudio with the following details: Title: Paul’s Doxology (sermon 1266) Subtitle: From the heart of Spurgeon Speaker: C. H. Spurgeon Broadcaster: Maidenbower Baptist Church Event: Podcast Date: 6/21/2024 Bible: Ephesians 3:20-21 Length: 33 min.…
…
continue reading
![Artwork](/static/images/128pixel.png)
1
June 19– Acts 2:4, “Filled with the Holy Spirit.”
2:30
2:30
Play later
Play later
Lists
Like
Liked
2:30
June 19– Morning by C. H. Spurgeon, revised and edited by W. C. Neff “Filled with the Holy Spirit.” —Acts 2:4 Today's FREE Transcript Get a copy of the book, Morning by Morning TODAY (contains all of the Daily Readings) Donate to Morning & Evening to support this Podcast. Thank you!By C. H. Spurgeon / W. C. Neff
…
continue reading
![Artwork](/static/images/128pixel.png)
1
The Portable Star by Isaac Asimov - Isaac Asimov Short Story
40:18
40:18
Play later
Play later
Lists
Like
Liked
40:18
Holden made love to his friends wife. Because he couldn’t help it. The Portable Star by Isaac Asimov, that’s next on The Lost Sci-Fi Podcast. There will come a time when we will run out of stories in the public domain to share with you that were written by Isaac Asimov, fortunately today, is not that day. Considering when it was published in 1955 t…
…
continue reading
My friend, the city's Disability Manager, Valerie Fatica is by to talk about the new location and activities as part of the Disabled and Proud Fest/Expo now happening with the Metroparks at Swan Creek on July 6. First, thank you China!By Eric Chase
…
continue reading
Gary Clark Jr talks with That Station in an interview before his Raleigh, NC at Red Hat amphitheater show. He talks about bringing his family on the road, his musical influences, and collaborating with Stevie Wonder. Stream That Station online at http://www.thatstation.net
…
continue reading